1.67 Rating by CuteStat

alexandriaconetta.com is 8 years 3 months old. It is a domain having com extension. It has a global traffic rank of #16196848 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, alexandriaconetta.com is SAFE to browse.

PageSpeed Score
83
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 30
Daily Pageviews: 60

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 16,196,848
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

89.234.11.194

Hosted Country:

United Kingdom GB

Location Latitude:

51.4964

Location Longitude:

-0.1224
alexandriaconetta.com | Sculptor / Artist

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 2
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 89.234.11.194)

Default Parallels Plesk Panel Page

- chrisbeetlesfinephotographs.com
Not Applicable $ 8.95

Default Parallels Plesk Panel Page

- nwinchester.com
Not Applicable $ 8.95

Default Parallels Plesk Panel Page

- yachtingpagesmarketingservices.com
Not Applicable $ 8.95

Default Parallels Plesk Panel Page

- theprint-room.com
Not Applicable $ 8.95

IT Support & Services Company Bristol | Evolvit

- supplement-zone.co.uk

Dedicated 24/7 IT Support Service from a Bristol IT Company that will bring all of your IT requirements under one roof. Fast and friendly IT Service.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 01 Feb 2016 05:06:02 GMT
Server: Apache
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Last-Modified: Mon, 01 Feb 2016 05:06:02 GMT
Cache-Control: post-check=0, pre-check=0
X-Powered-By: PleskLin
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 1513
Connection: close
Content-Type: text/html; charset=utf-8

Domain Information

Domain Registrar: Camelot 22, LLC
Registration Date: Jan 19, 2016, 12:00 AM 8 years 3 months 1 week ago
Last Modified: Jan 19, 2016, 12:00 AM 8 years 3 months 1 week ago
Expiration Date: Jan 19, 2017, 12:00 AM 7 years 3 months 1 week ago
Domain Status:
clientDeleteProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns.rackspace.com 69.20.95.4 United States of America United States of America
ns2.rackspace.com 65.61.188.4 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
alexandriaconetta.com A 21594 IP: 89.234.11.194
alexandriaconetta.com NS 21599 Target: ns.rackspace.com
alexandriaconetta.com NS 21599 Target: ns2.rackspace.com
alexandriaconetta.com SOA 299 MNAME: ns.rackspace.com
RNAME: hostmaster.rackspace.com
Serial: 1453874489
Refresh: 3600
Retry: 300
Expire: 1814400
Minimum TTL: 300
alexandriaconetta.com MX 21599 Priority: 10
Target: alexandriaconetta.com

Similarly Ranked Websites

4seohunt - Website Analyzer

- seohunt.net
16,196,918 $ 8.95


403 Forbidden

- vebtoday.com
16,196,934 $ 8.95

seo uzmanı, seo, uzmanı, seo uzmani, seo uzman, uzmanı, uzman seo, fre

- uzmani.co

seo uzmanı, seo, uzmanı, seo uzmani, seo uzman, uzmanı, uzman seo, freelance seo uzmanı, freelance seo, istanbul seo uzmanı, google seo uzmanı, www.uzmani.co

16,196,944 $ 8.95

hotlobbying.com

- hotlobbying.com
16,196,955 $ 8.95

Full WHOIS Lookup

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: ALEXANDRIACONETTA.COM
Registrar: WEBFUSION LTD.
Sponsoring Registrar IANA ID: 1515
Whois Server: whois.123-reg.co.uk
Referral URL: http://www.123-reg.co.uk
Name Server: NS.RACKSPACE.COM
Name Server: NS2.RACKSPACE.COM
Status: clientDeleteProhibited https://www.icann.org/epp#clientDeleteProhibited
Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Status: clientUpdateProhibited https://www.icann.org/epp#clientUpdateProhibited
Updated Date: 19-jan-2016
Creation Date: 19-jan-2016
Expiration Date: 19-jan-2017

>>> Last update of whois database: Mon, 01 Feb 2016 05:05:54 GMT